PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73588.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 405aa    MW: 44968.9 Da    PI: 5.1323
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73588.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.11e-101244043374
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 e L+e+A+a+ ++++ +aq+l++ l+e+ sp+gd  q+la+yf+++L  r+++s++++ +a+++ + ++ + +++  ++  f+evsP+ +f+h++aN a
  EPS73588.1  24 EILVEAARAMVERNAGRAQRLMWMLNEMGSPYGDVDQKLASYFLQGLFCRMTESGERTRRAMAAAAGNNCSFDSTRRVVLKFQEVSPWTTFGHVAANGA 122
                 689***********************************************************9999996666666666667****************** PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........skeeleetgerLakfAeelgvpfefnvlvak.rledlel 191
                 I+ea++ge r+Hi+D++ + ++QWp+Ll+a+a+R++++p+lR+T+v+              ++ ++e+g+r++kfA+ +gvpfef v+++  +++++++
  EPS73588.1 123 IMEALDGEGRLHIVDIGNTFCTQWPTLLEAIATRADEAPHLRLTAVVVTGDAaggkapaaLHRVMKEIGNRMEKFARLMGVPFEFGVVHHAgDVSEMDF 221
                 **********************************************996555789999988999***********************97767******* PP

        GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh....nsesFlerflealeyysalfdsleaklpreseerikvE 286
                 +eL+v++gEala+n+v +lh+++    ++e++rd+++ ++++l+P+vv++ve+ead+    ++++Fl +f e+l+++ + f++le++++++s+er ++E
  EPS73588.1 222 SELDVREGEALAINCVGALHSVP----ATEDRRDSLIAAFRTLRPRVVTIVEEEADLdvgyDGAEFLSGFRECLRWFRVYFEALEESFAKTSNERLMLE 316
                 **********************9....7888899********************7652122677*********************************** PP

        GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.yrve.eesgslvlgWkdrpLvsvSaWr 374
                 r+  gr++v+++ac  +++ er+et+++W++r++  G+ + +++e++ +++++llr++  +g  +++ e+s+ ++l+Wkd+p+v++SaWr
  EPS73588.1 317 RA-SGRAVVDLIACPPENSAERRETAARWSRRMHGGGYVTFSFNEEVRDDVRSLLRRYR-EGwSMLNcEDSAGIFLCWKDQPVVWASAWR 404
                 **.9*******************************************************.552444457788888**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.731383IPR005202Transcription factor GRAS
PfamPF035143.5E-9924404IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
SGATLSSDVA LVELSGQSPG WASEILVEAA RAMVERNAGR AQRLMWMLNE MGSPYGDVDQ  60
KLASYFLQGL FCRMTESGER TRRAMAAAAG NNCSFDSTRR VVLKFQEVSP WTTFGHVAAN  120
GAIMEALDGE GRLHIVDIGN TFCTQWPTLL EAIATRADEA PHLRLTAVVV TGDAAGGKAP  180
AALHRVMKEI GNRMEKFARL MGVPFEFGVV HHAGDVSEMD FSELDVREGE ALAINCVGAL  240
HSVPATEDRR DSLIAAFRTL RPRVVTIVEE EADLDVGYDG AEFLSGFREC LRWFRVYFEA  300
LEESFAKTSN ERLMLERASG RAVVDLIACP PENSAERRET AARWSRRMHG GGYVTFSFNE  360
EVRDDVRSLL RRYREGWSML NCEDSAGIFL CWKDQPVVWA SAWRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-295640437375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073684.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLS8ECB50.0S8ECB5_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20312464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]